OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLD5 (GINS4) (NM_032336) Human Mass Spec Standard

Be the first to review this product
SKU
PH303336
GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY403156 Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) (as WB positive control) 100 ug
$436.00

Other products for "SLD5 or NM_032336"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203336
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC203336 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT
IAPLVASGAVQLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115712
RefSeq Size 3841
RefSeq ORF 669
Synonyms SLD5
Locus ID 84296
UniProt ID Q9BRT9
Cytogenetics 8p11.21
Summary The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 PubMed 16287864). See GINS1 for additional information about the GINS complex.supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLD5" proteins (3)
SKU Description Size Price
LC403156 Lyophilized GINS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403156 Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) (as WB positive control) 100 ug
$436.00
TP303336 Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products