SLD5 (GINS4) (NM_032336) Human Mass Spec Standard

SKU
PH303336
GINS4 MS Standard C13 and N15-labeled recombinant protein (NP_115712)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203336]
Predicted MW 26 kDa
Protein Sequence
Protein Sequence
>RC203336 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT
IAPLVASGAVQLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115712
RefSeq Size 3841
RefSeq ORF 669
Synonyms SLD5
Locus ID 84296
UniProt ID Q9BRT9
Cytogenetics 8p11.21
Summary The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:SLD5 (GINS4) (NM_032336) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403156 GINS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403156 Transient overexpression lysate of GINS complex subunit 4 (Sld5 homolog) (GINS4) 100 ug
$436.00
TP303336 Recombinant protein of human GINS complex subunit 4 (Sld5 homolog) (GINS4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.