SLD5 (GINS4) (NM_032336) Human Tagged ORF Clone

SKU
RC203336
GINS4 (Myc-DDK-tagged)-Human GINS complex subunit 4 (Sld5 homolog) (GINS4)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SLD5
Synonyms SLD5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC203336 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGAAGAAGTGGATTTCCTGGGACAGGACTCTGATGGGGGTAGTGAGGAAGTGGTCCTAACTCCTG
CAGAGCTCATTGAAAGATTGGAGCAGGCCTGGATGAATGAAAAGTTTGCCCCTGAGCTGCTGGAGAGCAA
GCCTGAGATTGTAGAATGTGTCATGGAACAGCTGGAGCACATGGAAGAAAATCTCAGGAGAGCCAAAAGG
GAGGACCTGAAGGTCAGCATCCACCAAATGGAGATGGAGAGGATCCGCTACGTCCTCAGCAGCTACTTGC
GGTGTCGCCTCATGAAGATAGAGAAGTTTTTCCCTCATGTCCTTGAGAAGGAAAAAACACGTCCTGAGGG
GGAGCCTTCCAGCCTCTCGCCGGAAGAGTTGGCCTTTGCCAGAGAGTTCATGGCGAACACAGAGTCCTAT
CTGAAAAATGTCGCCTTGAAGCACATGCCCCCTAACTTACAGAAGGTGGACCTCTTTCGGGCAGTTCCCA
AACCAGATCTAGATTCTTACGTGTTTCTGAGAGTGAGAGAACGACAAGAAAACATACTGGTAGAACCAGA
CACAGATGAGCAGAGGGACTACGTGATTGACCTGGAGAAGGGCTCACAGCACTTGATCCGATACAAAACC
ATTGCACCTCTGGTTGCATCTGGAGCTGTCCAGCTAATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC203336 protein sequence
Red=Cloning site Green=Tags(s)

MTEEVDFLGQDSDGGSEEVVLTPAELIERLEQAWMNEKFAPELLESKPEIVECVMEQLEHMEENLRRAKR
EDLKVSIHQMEMERIRYVLSSYLRCRLMKIEKFFPHVLEKEKTRPEGEPSSLSPEELAFAREFMANTESY
LKNVALKHMPPNLQKVDLFRAVPKPDLDSYVFLRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKT
IAPLVASGAVQLI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032336
ORF Size 669 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032336.3
RefSeq Size 3841 bp
RefSeq ORF 672 bp
Locus ID 84296
UniProt ID Q9BRT9
Cytogenetics 8p11.21
MW 26 kDa
Summary The yeast heterotetrameric GINS complex is made up of Sld5, Psf1 (GINS1; MIM 610608), Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]). See GINS1 for additional information about the GINS complex.[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:SLD5 (GINS4) (NM_032336) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC203336L1 Lenti ORF clone of Human GINS complex subunit 4 (Sld5 homolog) (GINS4), Myc-DDK-tagged 10 ug
$600.00
RC203336L2 Lenti ORF clone of Human GINS complex subunit 4 (Sld5 homolog) (GINS4), mGFP tagged 10 ug
$600.00
RC203336L3 Lenti ORF clone of Human GINS complex subunit 4 (Sld5 homolog) (GINS4), Myc-DDK-tagged 10 ug
$600.00
RC203336L4 Lenti ORF clone of Human GINS complex subunit 4 (Sld5 homolog) (GINS4), mGFP tagged 10 ug
$600.00
RG203336 GINS4 (tGFP-tagged) - Human GINS complex subunit 4 (Sld5 homolog) (GINS4) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC123022 GINS4 (untagged)-Human GINS complex subunit 4 (Sld5 homolog) (GINS4) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.