TPMT (NM_000367) Human Mass Spec Standard

SKU
PH303309
TPMT MS Standard C13 and N15-labeled recombinant protein (NP_000358)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC203309]
Predicted MW 28.2 kDa
Protein Sequence
Protein Sequence
>RC203309 protein sequence
Red=Cloning site Green=Tags(s)

MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLC
GKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPR
TNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGK
ICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000358
RefSeq Size 3281
RefSeq ORF 735
Synonyms TPMTD
Locus ID 7172
UniProt ID P51580
Cytogenetics 6p22.3
Summary This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X. [provided by RefSeq, Aug 2014]
Protein Families Druggable Genome
Protein Pathways Drug metabolism - other enzymes
Write Your Own Review
You're reviewing:TPMT (NM_000367) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400131 TPMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400131 Transient overexpression lysate of thiopurine S-methyltransferase (TPMT) 100 ug
$436.00
TP303309 Recombinant protein of human thiopurine S-methyltransferase (TPMT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.