ZKSCAN3 (NM_024493) Human Mass Spec Standard

SKU
PH302971
ZKSCAN3 MS Standard C13 and N15-labeled recombinant protein (NP_077819)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202971]
Predicted MW 60.6 kDa
Protein Sequence
Protein Sequence
>RC202971 protein sequence
Red=Cloning site Green=Tags(s)

MARELSESTALDAQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGSRERFRGFRYPEAAGPREALSRLREL
CRQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPESGEEVVVLLEYLERQLDEPAPQVSGVDQ
GQELLCCKMALLTPAPGSQSSQFQLMKALLKHESVGSQPLQDRVLQVPMLAHGGCCREDAVVASRLTPES
QGLLKVEDVALTLTPEWTQQDSSQGNLCRDEKQENHGSLVSLGDEKQTKSRDLPPAEELPEKEHGKISCH
LREDIAQIPTCAEAGEQEGRLQRKQKNATGGRRHICHECGKSFAQSSGLSKHRRIHTGEKPYECEECGKA
FIGSSALVIHQRVHTGEKPYECEECGKAFSHSSDLIKHQRTHTGEKPYECDDCGKTFSQSCSLLEHHRIH
TGEKPYQCSMCGKAFRRSSHLLRHQRIHTGDKNVQEPEQGEAWKSRMESQLENVETPMSYKCNECERSFT
QNTGLIEHQKIHTGEKPYQCNACGKGFTRISYLVQHQRSHVGKNILSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077819
RefSeq Size 4725
RefSeq ORF 1614
Synonyms dJ874C20.1; dJ874C20.1.; ZF47; zfp-47; Zfp47; ZFP306; ZNF306; ZNF309; ZSCAN13; ZSCAN35
Locus ID 80317
UniProt ID Q9BRR0
Cytogenetics 6p22.1
Summary Transcriptional factor that binds to the consensus sequence 5'-[GT][AG][AGT]GGGG-3' and acts as a repressor of autophagy. Specifically represses expression of genes involved in autophagy and lysosome biogenesis/function such as MAP1LC3B, ULK1 or WIPI2. Associates with chromatin at the ITGB4 and VEGF promoters. Also acts as a transcription activator and promotes cancer cell progression and/or migration in various tumors and myelomas.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZKSCAN3 (NM_024493) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411284 ZKSCAN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411284 Transient overexpression lysate of zinc finger with KRAB and SCAN domains 3 (ZKSCAN3) 100 ug
$436.00
TP302971 Recombinant protein of human zinc finger with KRAB and SCAN domains 3 (ZKSCAN3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.