Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Mass Spec Standard

SKU
PH302924
NFE2 MS Standard C13 and N15-labeled recombinant protein (NP_006154)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202924]
Predicted MW 41.5 kDa
Protein Sequence
Protein Sequence
>RC202924 protein sequence
Red=Cloning site Green=Tags(s)

MSPCPPQQSRNRVIQLSTSELGEMELTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSI
HPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQE
DPESDSGLSLNYSDAESLELEGTEAGRRRSEYVEMYPVEYPYSLMPNSLAHSNYTLPAAETPLALEPSSG
PVRAKPTARGEAGSRDERRALAMKIPFPTDKIVNLPVDDFNELLARYPLTESQLALVRDIRRRGKNKVAA
QNCRKRKLETIVQLERELERLTNERERLLRARGEADRTLEVMRQQLTELYRDIFQHLRDESGNSYSPEEY
ALQQAADGTIFLVPRGTKMEATD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006154
RefSeq Size 1697
RefSeq ORF 1119
Synonyms NF-E2; p45
Locus ID 4778
UniProt ID Q16621
Cytogenetics 12q13.13
Summary Component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation. Binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. Requires MAFK or other small MAF proteins for binding to the NF-E2 motif. May play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron.[UniProtKB/Swiss-Prot Function]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:Nuclear Factor Erythroid Derived 2 (NFE2) (NM_006163) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401856 NFE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427772 NFE2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401856 Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 1 100 ug
$436.00
LY427772 Transient overexpression lysate of nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2 100 ug
$436.00
TP302924 Recombinant protein of human nuclear factor (erythroid-derived 2), 45kDa (NFE2), 20 µg 20 ug
$737.00
TP761189 Purified recombinant protein of Human nuclear factor (erythroid-derived 2), 45kDa (NFE2), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.