OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TSSC3 (PHLDA2) (NM_003311) Human Mass Spec Standard

Be the first to review this product
SKU
PH302884
PHLDA2 MS Standard C13 and N15-labeled recombinant protein (NP_003302)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA344404 Rabbit Polyclonal Anti-PHLDA2 Antibody - middle region
100 ul
$585.00
LY418773 Transient overexpression lysate of pleckstrin homology-like domain, family A, member 2 (PHLDA2) (as WB positive control) 100 ug
$436.00

Other products for "TSSC3 or NM_003311"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202884
Predicted MW 17.1 kDa
Protein Sequence
Protein Sequence
>RC202884 protein sequence
Red=Cloning site Green=Tags(s)

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYF
TIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEP
SRPSPQPKPRTP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003302
RefSeq Size 937
RefSeq ORF 456
Synonyms BRW1C; BWR1C; HLDA2; IPL; TSSC3
Locus ID 7262
UniProt ID Q53GA4
Cytogenetics 11p15.4
Summary This gene is located in a cluster of imprinted genes on chromosome 11p15.5, which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene has been shown to be imprinted, with preferential expression from the maternal allele in placenta and liver. provided by RefSeq, Oct 2010
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TSSC3" proteins (4)
SKU Description Size Price
LC418773 Lyophilized PHLDA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418773 Transient overexpression lysate of pleckstrin homology-like domain, family A, member 2 (PHLDA2) (as WB positive control) 100 ug
$436.00
TP302884 Recombinant protein of human pleckstrin homology-like domain, family A, member 2 (PHLDA2), 20 µg 20 ug
$737.00
TP720902 Purified recombinant protein of Human pleckstrin homology-like domain, family A, member 2 (PHLDA2) 10 ug
$275.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products