OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ICAD (DFFA) (NM_004401) Human Mass Spec Standard

Be the first to review this product
SKU
PH302879
DFFA MS Standard C13 and N15-labeled recombinant protein (NP_004392)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY418008 Transient overexpression lysate of DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "ICAD or NM_004401"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202879
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC202879 protein sequence
Red=Cloning site Green=Tags(s)

MEVTGDAGVPESGEIRTLKPCLLRRNYSREQHGVAASCLEDLRSKACDILAIDKSLTPVTLVLAEDGTIV
DDDDYFLCLPSNTKFVALASNEKWAYNNSDGGTAWISQESFDVDETDSGAGLKWKNVARQLKEDLSSIIL
LSEEDLQMLVDAPCSDLAQELRQSCATVQRLQHTLQQVLDQREEVRQSKQLLQLYLQALEKEGSLLSKQE
ESKAAFGEEVDAVDTGISRETSSDVALASHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIK
KTETVQEACEWELALRLQQTQSLHSLRSISASKASPPGDLQNPKRARQDPT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004392
RefSeq Size 2053
RefSeq ORF 993
Synonyms DFF-45; DFF1; ICAD
Locus ID 1676
UniProt ID O00273
Cytogenetics 1p36.22
Summary Apoptosis is a cell death process that removes toxic and/or useless cells during mammalian development. The apoptotic process is accompanied by shrinkage and fragmentation of the cells and nuclei and degradation of the chromosomal DNA into nucleosomal units. DNA fragmentation factor (DFF) is a heterodimeric protein of 40-kD (DFFB) and 45-kD (DFFA) subunits. DFFA is the substrate for caspase-3 and triggers DNA fragmentation during apoptosis. DFF becomes activated when DFFA is cleaved by caspase-3. The cleaved fragments of DFFA dissociate from DFFB, the active component of DFF. DFFB has been found to trigger both DNA fragmentation and chromatin condensation during apoptosis. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Pathways Apoptosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ICAD" proteins (4)
SKU Description Size Price
LC418008 Lyophilized DFFA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418008 Transient overexpression lysate of DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP302879 Recombinant protein of human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1, 20 µg 20 ug
$867.00
TP720857 Purified recombinant protein of Human DNA fragmentation factor, 45kDa, alpha polypeptide (DFFA), transcript variant 1 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products