PHAP1 (ANP32A) (NM_006305) Human Mass Spec Standard

SKU
PH302868
ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202868]
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC202868 protein sequence
Red=Cloning site Green=Tags(s)

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006296
RefSeq Size 2479
RefSeq ORF 747
Synonyms C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32
Locus ID 8125
UniProt ID P39687
Cytogenetics 15q23
Summary Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:PHAP1 (ANP32A) (NM_006305) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416747 ANP32A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416747 Transient overexpression lysate of acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) 100 ug
$436.00
TP302868 Recombinant protein of human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.