OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PHAP1 (ANP32A) (NM_006305) Human Mass Spec Standard

Be the first to review this product
SKU
PH302868
ANP32A MS Standard C13 and N15-labeled recombinant protein (NP_006296)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA345682 Rabbit Polyclonal Anti-ANP32A Antibody
100 ul
$585.00
LY416747 Transient overexpression lysate of acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) (as WB positive control) 100 ug
$436.00

Other products for "PHAP1 or NM_006305"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202868
Predicted MW 28.6 kDa
Protein Sequence
Protein Sequence
>RC202868 protein sequence
Red=Cloning site Green=Tags(s)

MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLE
LSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLP
QLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEED
EEGYNDGEVDDEEDEEELGEEERGQKRKREPEDEGEDDD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006296
RefSeq Size 2479
RefSeq ORF 747
Synonyms C15orf1; HPPCn; I1PP2A; LANP; MAPM; PHAP1; PHAPI; PP32
Locus ID 8125
UniProt ID P39687
Cytogenetics 15q23
Summary Implicated in a number of cellular processes, including proliferation, differentiation, caspase-dependent and caspase-independent apoptosis, suppression of transformation (tumor suppressor), inhibition of protein phosphatase 2A, regulation of mRNA trafficking and stability in association with ELAVL1, and inhibition of acetyltransferases as part of the INHAT (inhibitor of histone acetyltransferases) complex. Plays a role in E4F1-mediated transcriptional repression.UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PHAP1" proteins (3)
SKU Description Size Price
LC416747 Lyophilized ANP32A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416747 Transient overexpression lysate of acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A) (as WB positive control) 100 ug
$436.00
TP302868 Recombinant protein of human acidic (leucine-rich) nuclear phosphoprotein 32 family, member A (ANP32A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products