OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZNF346 (NM_012279) Human Mass Spec Standard

Be the first to review this product
SKU
PH302856
ZNF346 MS Standard C13 and N15-labeled recombinant protein (NP_036411)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326612 Rabbit Polyclonal ZNF346 (CT) Antibody
100 ug
$640.00
LY415847 Transient overexpression lysate of zinc finger protein 346 (ZNF346) (as WB positive control) 100 ug
$436.00

Other products for "ZNF346 or NM_012279"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202856
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC202856 protein sequence
Red=Cloning site Green=Tags(s)

MEYPAPATVQAADGGAAGPYSSSELLEGQEPDGVRFDRERARRLWEAVSGAQPVGREEVEHMIQKNQCLF
TNTQCKVCCALLISESQKLAHYQSKKHANKVKRYLAIHGMETLKGETKKLDSDQKSSRSKDKNQCCPICN
MTFSSPVVAQSHYLGKTHAKNLKLKQQSTKVEALHQNREMIDPDKFCSLCHATFNDPVMAQQHYVGKKHR
KQETKLKLMARYGRLADPAVTDFPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTVASSLGQIPM
QRQPIQKDSTTLED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036411
RefSeq Size 3089
RefSeq ORF 882
Synonyms JAZ; Zfp346
Locus ID 23567
UniProt ID Q9UL40
Cytogenetics 5q35.2
Summary The protein encoded by this gene is a nucleolar, zinc finger protein that preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids, rather than DNA alone. Mutational studies indicate that the zinc finger domains are not only essential for dsRNA binding, but are also required for its nucleolar localization. The encoded protein may be involved in cell growth and survival. It plays a role in protecting neurons by inhibiting cell cycle re-entry via stimulation of p21 gene expression. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Apr 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZNF346" proteins (3)
SKU Description Size Price
LC415847 Lyophilized ZNF346 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415847 Transient overexpression lysate of zinc finger protein 346 (ZNF346) (as WB positive control) 100 ug
$436.00
TP302856 Recombinant protein of human zinc finger protein 346 (ZNF346), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products