OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RAB14 (NM_016322) Human Mass Spec Standard

Be the first to review this product
SKU
PH302832
RAB14 MS Standard C13 and N15-labeled recombinant protein (NP_057406)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351570 Rabbit Polyclonal Anti-RAB14 Antibody
100 ul
$205.00
LY414055 Transient overexpression lysate of RAB14, member RAS oncogene family (RAB14) (as WB positive control) 100 ug
$436.00

Other products for "RAB14 or NM_016322"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202832
Predicted MW 23.9 kDa
Protein Sequence
Protein Sequence
>RC202832 protein sequence
Red=Cloning site Green=Tags(s)

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR
EGCGC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057406
RefSeq Size 4379
RefSeq ORF 645
Synonyms FBP; RAB-14
Locus ID 51552
UniProt ID P61106
Cytogenetics 9q33.2
Summary RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 PubMed 15004230).supplied by OMIM, Mar 2009
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RAB14" proteins (3)
SKU Description Size Price
LC414055 Lyophilized RAB14 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414055 Transient overexpression lysate of RAB14, member RAS oncogene family (RAB14) (as WB positive control) 100 ug
$436.00
TP302832 Recombinant protein of human RAB14, member RAS oncogene family (RAB14), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products