RAB14 (NM_016322) Human Tagged ORF Clone

SKU
RC202832
RAB14 (Myc-DDK-tagged)-Human RAB14, member RAS oncogene family (RAB14)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB14
Synonyms FBP; RAB-14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202832 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACTGCACCATACAACTACTCTTACATCTTTAAATATATTATTATTGGGGACATGGGAGTAGGAA
AATCTTGCTTGCTTCATCAATTTACAGAAAAAAAATTTATGGCTGATTGTCCTCACACAATTGGTGTTGA
ATTTGGTACAAGAATAATCGAAGTTAGTGGCCAAAAAATAAAACTGCAGATTTGGGATACGGCAGGACAG
GAGCGATTTAGGGCTGTTACACGGAGCTACTACAGAGGAGCTGCGGGAGCTCTTATGGTCTATGATATCA
CTAGAAGAAGTACATATAACCACTTAAGCAGCTGGTTGACAGATGCAAGGAATCTCACCAATCCAAATAC
TGTAATAATTCTCATAGGAAATAAAGCAGATTTGGAGGCACAGAGAGATGTTACATATGAAGAAGCCAAA
CAGTTTGCTGAAGAAAATGGCTTATTGTTCCTCGAAGCGAGTGCAAAAACGGGAGAGAATGTAGAAGATG
CCTTCCTTGAGGCTGCCAAGAAAATCTATCAGAACATTCAGGATGGAAGCTTGGATCTGAATGCTGCTGA
GTCTGGTGTACAACACAAACCTTCAGCCCCGCAGGGAGGCCGGCTAACCAGTGAACCCCAACCCCAGAGA
GAAGGCTGTGGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202832 protein sequence
Red=Cloning site Green=Tags(s)

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR
EGCGC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016322
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016322.4
RefSeq Size 4379 bp
RefSeq ORF 648 bp
Locus ID 51552
UniProt ID P61106
Cytogenetics 9q33.2
Domains RAB, RAN, ras, RAS, RHO
Protein Families Druggable Genome
MW 23.9 kDa
Summary RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009]
Write Your Own Review
You're reviewing:RAB14 (NM_016322) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202832L3 Lenti ORF clone of Human RAB14, member RAS oncogene family (RAB14), Myc-DDK-tagged 10 ug
$600.00
RC202832L4 Lenti ORF clone of Human RAB14, member RAS oncogene family (RAB14), mGFP tagged 10 ug
$600.00
RG202832 RAB14 (tGFP-tagged) - Human RAB14, member RAS oncogene family (RAB14) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC321525 RAB14 (untagged)-Human RAB14, member RAS oncogene family (RAB14) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.