FABP4 (NM_001442) Human Mass Spec Standard

SKU
PH302702
FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202702]
Predicted MW 14.7 kDa
Protein Sequence
Protein Sequence
>RC202702 representing NM_001442
Red=Cloning site Green=Tags(s)

MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001433
RefSeq Size 619
RefSeq ORF 396
Synonyms A-FABP; AFABP; ALBP; aP2; HEL-S-104
Locus ID 2167
UniProt ID P15090
Cytogenetics 8q21.13
Summary FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways PPAR signaling pathway
Write Your Own Review
You're reviewing:FABP4 (NM_001442) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400558 FABP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400558 Transient overexpression lysate of fatty acid binding protein 4, adipocyte (FABP4) 100 ug
$436.00
TP302702 Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4), 20 µg 20 ug
$737.00
TP720117 Recombinant protein of human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.