FABP4 (NM_001442) Human Mass Spec Standard

SKU PH302702

FABP4 MS Standard C13 and N15-labeled recombinant protein (NP_001433)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202702]
• Predicted MW: 14.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC202702 representing NM_001442; Red=Cloning site Green=Tags(s); ; MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE; FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001433
• RefSeq Size: 619
• RefSeq ORF: 396
• Synonyms: A-FABP; AFABP; ALBP; aP2; HEL-S-104
• Locus ID: 2167
• UniProt ID: P15090
• Cytogenetics: 8q21.13
• Summary: FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: PPAR signaling pathway