FABP4 (NM_001442) Human Tagged ORF Clone

SKU
RC202702
FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
5 Days*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FABP4
Synonyms A-FABP; AFABP; ALBP; aP2; HEL-S-104
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202702 representing NM_001442
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTGTGATGCTTTTGTAGGTACCTGGAAACTTGTCTCCAGTGAAAACTTTGATGATTATATGAAAGAAG
TAGGAGTGGGCTTTGCCACCAGGAAAGTGGCTGGCATGGCCAAACCTAACATGATCATCAGTGTGAATGG
GGATGTGATCACCATTAAATCTGAAAGTACCTTTAAAAATACTGAGATTTCCTTCATACTGGGCCAGGAA
TTTGACGAAGTCACTGCAGATGACAGGAAAGTCAAGAGCACCATAACCTTAGATGGGGGTGTCCTGGTAC
ATGTGCAGAAATGGGATGGAAAATCAACCACCATAAAGAGAAAACGAGAGGATGATAAACTGGTGGTGGA
ATGCGTCATGAAAGGCGTCACTTCCACGAGAGTTTATGAGAGAGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202702 representing NM_001442
Red=Cloning site Green=Tags(s)

MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKNTEISFILGQE
FDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVMKGVTSTRVYERA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001442
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001442.3
RefSeq Size 619 bp
RefSeq ORF 399 bp
Locus ID 2167
UniProt ID P15090
Cytogenetics 8q21.13
Protein Families Druggable Genome
Protein Pathways PPAR signaling pathway
MW 14.7 kDa
Summary FABP4 encodes the fatty acid binding protein found in adipocytes. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FABP4 (NM_001442) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202702L1 Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$450.00
RC202702L2 Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$450.00
RC202702L3 Lenti-ORF clone of FABP4 (Myc-DDK-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$450.00
RC202702L4 Lenti-ORF clone of FABP4 (mGFP-tagged)-Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$450.00
RG202702 FABP4 (tGFP-tagged) - Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$489.00
SC122594 FABP4 (untagged)-Human fatty acid binding protein 4, adipocyte (FABP4) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.