OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RPRM (NM_019845) Human Mass Spec Standard

Be the first to review this product
SKU
PH302634
RPRM MS Standard C13 and N15-labeled recombinant protein (NP_062819)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY412715 Transient overexpression lysate of reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) (as WB positive control) 100 ug
$436.00

Other products for "RPRM or NM_019845"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202634
Predicted MW 11.8 kDa
Protein Sequence
Protein Sequence
>RC202634 protein sequence
Red=Cloning site Green=Tags(s)

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_062819
RefSeq Size 1496
RefSeq ORF 327
Synonyms REPRIMO
Locus ID 56475
UniProt ID Q9NS64
Cytogenetics 2q23.3
Summary May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Protein Pathways p53 signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RPRM" proteins (3)
SKU Description Size Price
LC412715 Lyophilized RPRM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412715 Transient overexpression lysate of reprimo, TP53 dependent G2 arrest mediator candidate (RPRM) (as WB positive control) 100 ug
$436.00
TP302634 Recombinant protein of human reprimo, TP53 dependent G2 arrest mediator candidate (RPRM), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products