RPRM (NM_019845) Human Mass Spec Standard

SKU PH302634

RPRM MS Standard C13 and N15-labeled recombinant protein (NP_062819)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202634]
• Predicted MW: 11.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC202634 protein sequence; Red=Cloning site Green=Tags(s); ; MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV; FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062819
• RefSeq Size: 1496
• RefSeq ORF: 327
• Synonyms: REPRIMO
• Locus ID: 56475
• UniProt ID: Q9NS64
• Cytogenetics: 2q23.3
• Summary: May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane
• Protein Pathways: p53 signaling pathway