Aldolase (ALDOA) (NM_000034) Human Mass Spec Standard

SKU
PH302576
ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_000025)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202576]
Predicted MW 39.4 kDa
Protein Sequence
Protein Sequence
>RC202576 protein sequence
Red=Cloning site Green=Tags(s)

MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV
NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK
DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL
AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA
SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG
AAASESLFVSNHAY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000025
RefSeq Size 2408
RefSeq ORF 1092
Synonyms ALDA; GSD12; HEL-S-87p
Locus ID 226
UniProt ID P04075 V9HWN7
Cytogenetics 16p11.2
Summary This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017]
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway
Write Your Own Review
You're reviewing:Aldolase (ALDOA) (NM_000034) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303900 ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908930) 10 ug
$3,255.00
PH303908 ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908932) 10 ug
$3,255.00
PH325547 ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_001121089) 10 ug
$3,255.00
LC400006 ALDOA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405206 ALDOA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405207 ALDOA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426825 ALDOA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400006 Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 100 ug
$436.00
LY405206 Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 100 ug
$436.00
LY405207 Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 100 ug
$436.00
LY426825 Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 100 ug
$436.00
TP302576 Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1, 20 µg 20 ug
$737.00
TP303900 Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2, 20 µg 20 ug
$737.00
TP303908 Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3, 20 µg 20 ug
$737.00
TP325547 Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4, 20 µg 20 ug
$737.00
TP720179 Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.