Aldolase (ALDOA) (NM_000034) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC202576] |
Predicted MW | 39.4 kDa |
Protein Sequence |
Protein Sequence
>RC202576 protein sequence
Red=Cloning site Green=Tags(s) MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000025 |
RefSeq Size | 2408 |
RefSeq ORF | 1092 |
Synonyms | ALDA; GSD12; HEL-S-87p |
Locus ID | 226 |
UniProt ID | P04075 V9HWN7 |
Cytogenetics | 16p11.2 |
Summary | This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10. [provided by RefSeq, Sep 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH303900 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908930) | 10 ug |
$3,255.00
|
|
PH303908 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_908932) | 10 ug |
$3,255.00
|
|
PH325547 | ALDOA MS Standard C13 and N15-labeled recombinant protein (NP_001121089) | 10 ug |
$3,255.00
|
|
LC400006 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405206 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405207 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426825 | ALDOA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400006 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 | 100 ug |
$436.00
|
|
LY405206 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2 | 100 ug |
$436.00
|
|
LY405207 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3 | 100 ug |
$436.00
|
|
LY426825 | Transient overexpression lysate of aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4 | 100 ug |
$436.00
|
|
TP302576 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP303900 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP303908 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP325547 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP720179 | Recombinant protein of human aldolase A, fructose-bisphosphate (ALDOA), transcript variant 1 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.