RBM4B (NM_031492) Human Mass Spec Standard

SKU
PH302569
RBM4B MS Standard C13 and N15-labeled recombinant protein (NP_113680)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202569]
Predicted MW 40.1 kDa
Protein Sequence
Protein Sequence
>RC202569 protein sequence
Red=Cloning site Green=Tags(s)

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS
KNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMY
YNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSG
AAATSAAMAAAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQY
VDRARYSAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113680
RefSeq Size 1844
RefSeq ORF 1077
Synonyms RBM4L; RBM30; ZCCHC15; ZCCHC21B; ZCRB3B
Locus ID 83759
UniProt ID Q9BQ04
Cytogenetics 11q13.2
Summary Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3' UTR of the PER1 mRNA (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RBM4B (NM_031492) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410488 RBM4B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410488 Transient overexpression lysate of RNA binding motif protein 4B (RBM4B) 100 ug
$436.00
TP302569 Recombinant protein of human RNA binding motif protein 4B (RBM4B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.