RBM4B Rabbit Polyclonal Antibody

SKU TA343945

Rabbit Polyclonal Anti-RBM4B Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM4B antibody: synthetic peptide directed towards the C terminal of human RBM4B. Synthetic peptide located within the following region: AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: RNA binding motif protein 4B
• Database Link:
  NP_113680
  Q9BQ04
• Background: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.
• Synonyms: RBM4L; RBM30; ZCCHC15; ZCCHC21B; ZCRB3B
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 86%; Mouse: 86%; Goat: 85%

Reference Data