PPPDE1 (DESI2) (NM_016076) Human Mass Spec Standard

SKU
PH302524
PPPDE1 MS Standard C13 and N15-labeled recombinant protein (NP_057160)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202524]
Predicted MW 21.4 kDa
Protein Sequence
Protein Sequence
>RC202524 protein sequence
Red=Cloning site Green=Tags(s)

MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNASELGETFKFK
EAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPF
LQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHTKL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057160
RefSeq Size 4109
RefSeq ORF 582
Synonyms C1orf121; CGI-146; DESI; DeSI-2; DESI1; FAM152A; PNAS-4; PPPDE1
Locus ID 51029
UniProt ID Q9BSY9
Cytogenetics 1q44
Summary Has deubiquitinating activity towards 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. Deubiquitinates 'Lys-48'-linked polyubiquitination of RPS7 leading to its stabilization (PubMed:28483520).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PPPDE1 (DESI2) (NM_016076) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414201 DESI2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414201 Transient overexpression lysate of PPPDE peptidase domain containing 1 (PPPDE1) 100 ug
$436.00
TP302524 Recombinant protein of human PPPDE peptidase domain containing 1 (PPPDE1), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.