PPPDE1 (DESI2) Rabbit Polyclonal Antibody

SKU
TA346132
Rabbit Polyclonal Anti-DESI2 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-DESI2 antibody is: synthetic peptide directed towards the C-terminal region of Human DESI2. Synthetic peptide located within the following region: SCLPKEWLTPAALQSSVSQELQDELEEAEDAAASASVASTAAGSRPGRHT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 21 kDa
Gene Name desumoylating isopeptidase 2
Database Link
Background DESI2 is a protease which may deconjugate SUMO from some substrate proteins.
Synonyms C1orf121; CGI-146; DESI; DeSI-2; DESI1; FAM152A; PNAS-4; PPPDE1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Write Your Own Review
You're reviewing:PPPDE1 (DESI2) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.