MMP1 (NM_002421) Human Mass Spec Standard

SKU
PH302460
MMP1 MS Standard C13 and N15-labeled recombinant protein (NP_002412)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202460]
Predicted MW 54 kDa
Protein Sequence
Protein Sequence
>RC202460 protein sequence
Red=Cloning site Green=Tags(s)

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL
WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY
NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS
KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA
VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002412
RefSeq Size 2081
RefSeq ORF 1407
Synonyms CLG; CLGN
Locus ID 4312
UniProt ID P03956
Cytogenetics 11q22.2
Summary This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down the interstitial collagens, including types I, II, and III. The gene is part of a cluster of MMP genes on chromosome 11. Mutations in this gene are associated with chronic obstructive pulmonary disease (COPD). Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Protease, Secreted Protein
Protein Pathways Bladder cancer, Pathways in cancer, PPAR signaling pathway
Write Your Own Review
You're reviewing:MMP1 (NM_002421) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419340 MMP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419340 Transient overexpression lysate of matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 100 ug
$436.00
TP302460 Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720322 Recombinant protein of human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 10 ug
$330.00
TP723882 Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1 10 ug
$465.00
TP760405 Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$261.00
TP762607 Purified recombinant protein of Human matrix metallopeptidase 1 (interstitial collagenase) (MMP1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E.coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.