TRAP alpha (SSR1) (NM_003144) Human Mass Spec Standard

SKU
PH302408
SSR1 MS Standard C13 and N15-labeled recombinant protein (NP_003135)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202408]
Predicted MW 32.2 kDa
Protein Sequence
Protein Sequence
>RC202408 protein sequence
Red=Cloning site Green=Tags(s)

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE
EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL
PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM
YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR
SVGSDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003135
RefSeq Size 9793
RefSeq ORF 858
Synonyms TRAPA
Locus ID 6745
UniProt ID P43307
Cytogenetics 6p24.3
Summary The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TRAP alpha (SSR1) (NM_003144) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401093 SSR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401093 Transient overexpression lysate of signal sequence receptor, alpha (SSR1) 100 ug
$436.00
TP302408 Recombinant protein of human signal sequence receptor, alpha (SSR1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.