TRAP alpha (SSR1) (NM_003144) Human Tagged ORF Clone

SKU
RC202408
SSR1 (Myc-DDK-tagged)-Human signal sequence receptor, alpha (SSR1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRAP alpha
Synonyms TRAPA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202408 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCG
GCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAAT
TGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATAAAGAGGAA
GAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAG
ATTTTCCAGCAAATAACATTGTGAAGTTCCTGGTAGGCTTTACCAACAAGGGTACAGAAGATTTTATTGT
TGAATCCTTAGATGCCTCATTCCGTTATCCTCAGGACTACCAGTTTTATATCCAGAATTTCACAGCTCTT
CCTCTGAACACTGTAGTGCCACCCCAGAGACAGGCAACTTTTGAGTACTCTTTCATTCCTGCAGAGCCCA
TGGGCGGACGACCATTTGGTTTGGTCATCAATCTGAACTACAAAGATTTGAACGGCAATGTATTCCAAGA
TGCAGTCTTCAATCAAACAGTTACAGTTATTGAAAGAGAGGATGGGTTAGATGGAGAAACAATCTTTATG
TATATGTTCCTTGCTGGTCTTGGGCTTCTGGTTATTGTTGGCCTTCATCAACTCCTAGAATCTAGAAAGC
GTAAGAGACCCATACAGAAAGTAGAAATGGGTACATCAAGTCAGAATGATGTTGACATGAGTTGGATTCC
TCAGGAAACATTGAATCAAATCAATAAAGCTTCACCAAGAAGGTTGCCCAGGAAACGGGCACAGAAGAGA
TCAGTGGGATCTGATGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202408 protein sequence
Red=Cloning site Green=Tags(s)

MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEE
EDVSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTAL
PLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFM
YMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKR
SVGSDE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003144
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003144.5
RefSeq Size 9793 bp
RefSeq ORF 861 bp
Locus ID 6745
UniProt ID P43307
Cytogenetics 6p24.3
Domains TRAP_alpha
Protein Families Druggable Genome, Transmembrane
MW 32.2 kDa
Summary The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:TRAP alpha (SSR1) (NM_003144) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202408L1 Lenti ORF clone of Human signal sequence receptor, alpha (SSR1), Myc-DDK-tagged 10 ug
$600.00
RC202408L2 Lenti ORF clone of Human signal sequence receptor, alpha (SSR1), mGFP tagged 10 ug
$600.00
RC202408L3 Lenti ORF clone of Human signal sequence receptor, alpha (SSR1), Myc-DDK-tagged 10 ug
$600.00
RC202408L4 Lenti ORF clone of Human signal sequence receptor, alpha (SSR1), mGFP tagged 10 ug
$600.00
RG202408 SSR1 (tGFP-tagged) - Human signal sequence receptor, alpha (SSR1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC319121 SSR1 (untagged)-Human signal sequence receptor, alpha (SSR1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.