LYRM4 (NM_020408) Human Mass Spec Standard

SKU PH302346

LYRM4 MS Standard C13 and N15-labeled recombinant protein (NP_065141)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202346]
• Predicted MW: 10.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC202346 protein sequence; Red=Cloning site Green=Tags(s); ; MAASSRAQVLALYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLGVIRRQV; HIGQLYSTDKLIIENRDMPRT; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_065141
• RefSeq Size: 1514
• RefSeq ORF: 273
• Synonyms: C6orf149; CGI-203; COXPD19; ISD11
• Locus ID: 57128
• UniProt ID: Q9HD34
• Cytogenetics: 6p25.1
• Summary: The protein encoded by this gene is found in both mitochondria and the nucleus, where it binds cysteine desulfurase and helps free inorganic sulfur for Fe/S clusters. Disruption of this gene negatively impacts mitochondrial and cytosolic iron homeostasis. [provided by RefSeq, Sep 2016]