LYRM4 Rabbit Polyclonal Antibody

SKU
TA344783
Rabbit Polyclonal Anti-Lyrm4 Antibody - middle region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Lyrm4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 10 kDa
Gene Name LYR motif containing 4
Database Link
Background Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.
Synonyms C6orf149; CGI-203; COXPD19; ISD11
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
Write Your Own Review
You're reviewing:LYRM4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.