UBA5 (NM_024818) Human Mass Spec Standard

SKU
PH302327
UBA5 MS Standard C13 and N15-labeled recombinant protein (NP_079094)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202327]
Predicted MW 44.7 kDa
Protein Sequence
Protein Sequence
>RC202327 representing NM_024818
Red=Cloning site Green=Tags(s)

MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK
IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP
DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN
AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS
FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS
EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_079094
RefSeq Size 2720
RefSeq ORF 1212
Synonyms DEE44; EIEE44; SCAR24; THIFP1; UBE1DC1
Locus ID 79876
UniProt ID Q9GZZ9
Cytogenetics 3q22.1
Summary This gene encodes a member of the E1-like ubiquitin-activating enzyme family. This protein activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been identified on chromosome 1. [provided by RefSeq, Feb 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:UBA5 (NM_024818) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405021 UBA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411039 UBA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405021 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 2 100 ug
$436.00
LY411039 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 100 ug
$436.00
TP302327 Recombinant protein of human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1, 20 µg 20 ug
$737.00
TP721148 Purified recombinant protein of Human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.