UBA5 (NM_024818) Human Recombinant Protein

SKU
TP302327
Recombinant protein of human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202327 representing NM_024818
Red=Cloning site Green=Tags(s)

MAESVERLQQRVQELERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK
IRTFAVAIVGVGGVGSVTAEMLTRCGIGKLLLFDYDKVELANMNRLFFQPHQAGLSKVQAAEHTLRNINP
DVLFEVHNYNITTVENFQHFMDRISNGGLEEGKPVDLVLSCVDNFEARMTINTACNELGQTWMESGVSEN
AVSGHIQLIIPGESACFACAPPLVVAANIDEKTLKREGVCAASLPTTMGVVAGILVQNVLKFLLNFGTVS
FYLGYNAMQDFFPTMSMKPNPQCDDRNCRKQQEEYKKKVAALPKQEVIQEEEEIIHEDNEWGIELVSEVS
EEELKNFSGPVPDLPEGITVAYTIPKKQEDSVTELTVEDSGESLEDLMAKMKNM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 44.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079094
Locus ID 79876
UniProt ID Q9GZZ9
Cytogenetics 3q22.1
RefSeq Size 2720
RefSeq ORF 1212
Synonyms DEE44; EIEE44; SCAR24; THIFP1; UBE1DC1
Summary This gene encodes a member of the E1-like ubiquitin-activating enzyme family. This protein activates ubiquitin-fold modifier 1, a ubiquitin-like post-translational modifier protein, via the formation of a high-energy thioester bond. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been identified on chromosome 1. [provided by RefSeq, Feb 2016]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:UBA5 (NM_024818) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302327 UBA5 MS Standard C13 and N15-labeled recombinant protein (NP_079094) 10 ug
$3,255.00
LC405021 UBA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC411039 UBA5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405021 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 2 100 ug
$436.00
LY411039 Transient overexpression lysate of ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 100 ug
$436.00
TP721148 Purified recombinant protein of Human ubiquitin-like modifier activating enzyme 5 (UBA5), transcript variant 1 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.