OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MED30 (NM_080651) Human Mass Spec Standard

Be the first to review this product
SKU
PH302305
MED30 MS Standard C13 and N15-labeled recombinant protein (NP_542382)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA808041 MED30 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3) 100 ul
$447.00
LY409121 Transient overexpression lysate of mediator complex subunit 30 (MED30) (as WB positive control) 100 ug
$436.00

Other products for "MED30 or NM_080651"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202305
Predicted MW 20.3 kDa
Protein Sequence
Protein Sequence
>RC202305 protein sequence
Red=Cloning site Green=Tags(s)

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT
YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR
EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542382
RefSeq Size 994
RefSeq ORF 534
Synonyms MED30S; THRAP6; TRAP25
Locus ID 90390
UniProt ID Q96HR3
Cytogenetics 8q24.11
Summary The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 PubMed 11909976).supplied by OMIM, Nov 2010
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MED30" proteins (3)
SKU Description Size Price
LC409121 Lyophilized MED30 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY409121 Transient overexpression lysate of mediator complex subunit 30 (MED30) (as WB positive control) 100 ug
$436.00
TP302305 Recombinant protein of human mediator complex subunit 30 (MED30), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products