MED30 (NM_080651) Human Mass Spec Standard

SKU
PH302305
MED30 MS Standard C13 and N15-labeled recombinant protein (NP_542382)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202305]
Predicted MW 20.3 kDa
Protein Sequence
Protein Sequence
>RC202305 protein sequence
Red=Cloning site Green=Tags(s)

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGT
YQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERR
EIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_542382
RefSeq Size 994
RefSeq ORF 534
Synonyms MED30S; THRAP6; TRAP25
Locus ID 90390
UniProt ID Q96HR3
Cytogenetics 8q24.11
Summary The multiprotein TRAP/Mediator complex facilitates gene expression through a wide variety of transcriptional activators. MED30 is a component of this complex that appears to be metazoan specific (Baek et al., 2002 [PubMed 11909976]).[supplied by OMIM, Nov 2010]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:MED30 (NM_080651) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409121 MED30 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409121 Transient overexpression lysate of mediator complex subunit 30 (MED30) 100 ug
$436.00
TP302305 Recombinant protein of human mediator complex subunit 30 (MED30), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.