ORMDL3 (NM_139280) Human Mass Spec Standard

SKU
PH302279
ORMDL3 MS Standard C13 and N15-labeled recombinant protein (NP_644809)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202279]
Predicted MW 17.5 kDa
Protein Sequence
Protein Sequence
>RC202279 protein sequence
Red=Cloning site Green=Tags(s)

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP
QLHGVRIFGINKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_644809
RefSeq Size 2169
RefSeq ORF 459
Locus ID 94103
UniProt ID Q8N138
Cytogenetics 17q21.1
Summary Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ORMDL3 (NM_139280) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC408336 ORMDL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408336 Transient overexpression lysate of ORM1-like 3 (S. cerevisiae) (ORMDL3) 100 ug
$436.00
TP302279 Recombinant protein of human ORM1-like 3 (S. cerevisiae) (ORMDL3), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.