OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ORMDL3 (NM_139280) Human Mass Spec Standard

Be the first to review this product
SKU
PH302279
ORMDL3 MS Standard C13 and N15-labeled recombinant protein (NP_644809)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA358697 ORMDL3 Antibody - N-terminal region
100 ul
$585.00
LY408336 Transient overexpression lysate of ORM1-like 3 (S. cerevisiae) (ORMDL3) (as WB positive control) 100 ug
$436.00

Other products for "ORMDL3 or NM_139280"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202279
Predicted MW 17.5 kDa
Protein Sequence
Protein Sequence
>RC202279 protein sequence
Red=Cloning site Green=Tags(s)

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP
QLHGVRIFGINKY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_644809
RefSeq Size 2169
RefSeq ORF 459
Locus ID 94103
UniProt ID Q8N138
Cytogenetics 17q21.1
Summary Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ORMDL3" proteins (3)
SKU Description Size Price
LC408336 Lyophilized ORMDL3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408336 Transient overexpression lysate of ORM1-like 3 (S. cerevisiae) (ORMDL3) (as WB positive control) 100 ug
$436.00
TP302279 Recombinant protein of human ORM1-like 3 (S. cerevisiae) (ORMDL3), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products