OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ORMDL3 (NM_139280) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202279
ORMDL3 (Myc-DDK-tagged)-Human ORM1-like 3 (S. cerevisiae) (ORMDL3)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA358697 ORMDL3 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ORMDL3 or NM_139280"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ORMDL3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGC
TCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGT
CGTCTGGACCCTCACCAACCTCATTCACAACATGGGCATGTATATCTTCCTGCACACGGTGAAGGGGACA
CCCTTTGAGACCCCGGACCAGGGCAAGGCGAGGCTGCTAACCCACTGGGAGCAGATGGATTATGGGGTCC
AGTTCACGGCCTCTCGGAAGTTCTTGACCATCACACCCATCGTGCTGTACTTCCTCACCAGCTTCTACAC
TAAGTACGACCAGATCCATTTTGTGCTCAACACCGTGTCCCTGATGAGCGTGCTTATCCCCAAGCTGCCC
CAGCTCCACGGAGTCCGGATTTTTGGAATCAATAAGTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202279 protein sequence
Red=Cloning site Green=Tags(s)

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP
QLHGVRIFGINKY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_139280
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_139280.4
RefSeq Size 2169 bp
RefSeq ORF 462 bp
Locus ID 94103
UniProt ID Q8N138, A0A024R1W6
Cytogenetics 17q21.1
Protein Families Transmembrane
MW 17.5 kDa
Summary Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_139280" in other vectors (6)
SKU Description Size Price
RC202279L1 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), Myc-DDK-tagged 10 ug
$450.00
RC202279L2 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), mGFP tagged 10 ug
$450.00
RC202279L3 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), Myc-DDK-tagged 10 ug
$450.00
RC202279L4 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), mGFP tagged 10 ug
$450.00
RG202279 ORMDL3 (tGFP-tagged) - Human ORM1-like 3 (S. cerevisiae) (ORMDL3) 10 ug
$489.00
SC321992 ORMDL3 (untagged)-Human ORM1-like 3 (S. cerevisiae) (ORMDL3) 10 ug
$150.00

Plasmid Map for RC202279

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202279
Circular map for RC202279

file-alt Citations

ORMDL mislocalization by impaired autophagy in Niemann-Pick type C disease leads to increased de novo sphingolipid biosynthesis
Brown, Mahawar, Wattenberg et al
J Lipid Res (2024) 65 (6), 100556 DOI: 10.1016/j.jlr.2024.100556
Cited by 7
AI Summary: OriGene products, specifically the ORMDL3-FLAG plasmid (#RC202279) and the vector control (#PS100001), were used to overexpress human ORMDL3 in HeLa cells to investigate its role in sphingolipid biosynthesis and autophagy in Niemann-Pick type C disease.
Snippet: For overexpression of human ORMDL3, HeLa cells were grown to 70% confluence in 12-well plates or on coverslips for immunofluorescence, where indicated. The next day, the medium was replaced with a transfection mix containing 1 μg of ORMDL3-FLAG plasmid (#RC202279, NM_139280, Origene) or vector control (#PS100001, Origene), and 3 μl LipofectAMINE 2000 (#11668019, ThermoFisher) as previously described (20)
Discovering the genes mediating the interactions between chronic respiratory diseases in the human interactome
Maiorino, Baek, Guo et al
Nat Commun (2020) 11 (1), 811 DOI: 10.1038/s41467-020-14600-w
Cited by 38
AI Summary: OriGene products, specifically the GSDMB Myc-DDK-tagged cDNA (RC209488) and GSDMB siRNA (SR30004), were used in in vitro experiments to manipulate GSDMB expression, enabling the authors to validate candidate mediator genes identified by their Flow Centrality analysis in the context of asthma and COPD interactions.
FigureFigureFigure
ORMDL/serine palmitoyltransferase stoichiometry determines effects of ORMDL3 expression on sphingolipid biosynthesis
Siow, Sunkara, Dunn-Giroux et al
J. Lipid Res. (2015)
AI Summary: OriGene products contributed to this study by providing the pCMV6-XL5 vector and the epitope-tagged ORMDL3 plasmid (Myc- and FLAG-tagged ORMDL3 in pCMV6), which were used for cloning and overexpression experiments to investigate the effects of ORMDL3 on sphingolipid biosynthesis.
Snippet: XbaI site of pCMV6—XL5 (Origene) by In-Fusion cloning (Clontech, Mountain View, CA) according to the manufacturer's ... ORMDL3 in pCMV6 (epitope-tagged with Myc and FLAG, both at the carboxy-terminus) purchased from Origene (Rockville ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products