ORMDL3 (NM_139280) Human Tagged ORF Clone

SKU
RC202279
ORMDL3 (Myc-DDK-tagged)-Human ORM1-like 3 (S. cerevisiae) (ORMDL3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ORMDL3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202279 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTGGGCACAGCGCACAGCGAGGTGAACCCCAACACGCGGGTGATGAACAGCCGTGGCATCTGGC
TCTCCTACGTGCTGGCCATCGGTCTCCTCCACATCGTGCTGCTGAGCATCCCGTTTGTGAGTGTCCCTGT
CGTCTGGACCCTCACCAACCTCATTCACAACATGGGCATGTATATCTTCCTGCACACGGTGAAGGGGACA
CCCTTTGAGACCCCGGACCAGGGCAAGGCGAGGCTGCTAACCCACTGGGAGCAGATGGATTATGGGGTCC
AGTTCACGGCCTCTCGGAAGTTCTTGACCATCACACCCATCGTGCTGTACTTCCTCACCAGCTTCTACAC
TAAGTACGACCAGATCCATTTTGTGCTCAACACCGTGTCCCTGATGAGCGTGCTTATCCCCAAGCTGCCC
CAGCTCCACGGAGTCCGGATTTTTGGAATCAATAAGTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202279 protein sequence
Red=Cloning site Green=Tags(s)

MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGT
PFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLP
QLHGVRIFGINKY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_139280
ORF Size 459 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_139280.4
RefSeq Size 2169 bp
RefSeq ORF 462 bp
Locus ID 94103
UniProt ID Q8N138
Cytogenetics 17q21.1
Protein Families Transmembrane
MW 17.5 kDa
Summary Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ORMDL3 (NM_139280) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202279L1 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), Myc-DDK-tagged 10 ug
$450.00
RC202279L2 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), mGFP tagged 10 ug
$450.00
RC202279L3 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), Myc-DDK-tagged 10 ug
$450.00
RC202279L4 Lenti ORF clone of Human ORM1-like 3 (S. cerevisiae) (ORMDL3), mGFP tagged 10 ug
$450.00
RG202279 ORMDL3 (tGFP-tagged) - Human ORM1-like 3 (S. cerevisiae) (ORMDL3) 10 ug
$489.00
SC321992 ORMDL3 (untagged)-Human ORM1-like 3 (S. cerevisiae) (ORMDL3) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.