OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FKBP25 (FKBP3) (NM_002013) Human Mass Spec Standard

Be the first to review this product
SKU
PH302200
FKBP3 MS Standard C13 and N15-labeled recombinant protein (NP_002004)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370935 FKBP3 rabbit polyclonal antibody
100 ul
$310.00
LY400736 Transient overexpression lysate of FK506 binding protein 3, 25kDa (FKBP3) (as WB positive control) 100 ug
$436.00

Other products for "FKBP25 or NM_002013"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC202200
Predicted MW 25.2 kDa
Protein Sequence
Protein Sequence
>RC202200 protein sequence
Red=Cloning site Green=Tags(s)

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK
RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ
DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP
NAKLTFEVELVDID

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002004
RefSeq Size 1353
RefSeq ORF 672
Synonyms FKBP-3; FKBP-25; FKBP25; PPIase
Locus ID 2287
UniProt ID Q00688
Cytogenetics 14q21.2
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. provided by RefSeq, Sep 2008
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "FKBP25" proteins (4)
SKU Description Size Price
LC400736 Lyophilized FKBP3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400736 Transient overexpression lysate of FK506 binding protein 3, 25kDa (FKBP3) (as WB positive control) 100 ug
$436.00
TP302200 Recombinant protein of human FK506 binding protein 3, 25kDa (FKBP3), 20 µg 20 ug
$867.00
TP721192 Purified recombinant protein of Human FK506 binding protein 3, 25kDa (FKBP3) 10 ug
$190.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products