FKBP25 (FKBP3) (NM_002013) Human Tagged ORF Clone

SKU
RC202200
FKBP3 (Myc-DDK-tagged)-Human FK506 binding protein 3, 25kDa (FKBP3)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FKBP25
Synonyms FKBP-3; FKBP-25; FKBP25; PPIase
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202200 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCCGTTCCACAGCGGGCGTGGACCGTGGAGCAGCTGCGCAGTGAGCAGCTGCCCAAGAAGG
ACATTATCAAGTTTCTGCAGGAACACGGTTCAGATTCGTTTCTTGCAGAACATAAATTATTAGGAAACAT
TAAAAATGTGGCCAAGACAGCTAACAAGGACCACTTGGTTACAGCCTATAACCATCTTTTTGAAACTAAG
CGTTTTAAGGGTACTGAAAGTATAAGTAAAGTGTCTGAGCAAGTAAAAAATGTGAAGCTTAATGAAGATA
AACCCAAAGAAACCAAGTCTGAAGAGACCCTGGATGAGGGTCCACCAAAATATACTAAATCTGTTCTGAA
AAAGGGAGATAAAACCAACTTTCCCAAAAAGGGAGATGTTGTTCACTGCTGGTATACAGGAACACTACAA
GATGGGACTGTTTTTGATACTAATATTCAAACAAGTGCAAAGAAGAAGAAAAATGCCAAGCCTTTAAGTT
TTAAGGTCGGAGTAGGCAAAGTTATCAGAGGATGGGATGAAGCTCTCTTGACTATGAGTAAAGGAGAAAA
GGCTCGACTGGAGATTGAACCAGAATGGGCTTACGGAAAGAAAGGACAGCCTGATGCCAAAATTCCACCA
AATGCAAAACTCACTTTTGAAGTGGAATTAGTGGATATTGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202200 protein sequence
Red=Cloning site Green=Tags(s)

MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETK
RFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQ
DGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPP
NAKLTFEVELVDID

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002013
ORF Size 672 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002013.4
RefSeq Size 1353 bp
RefSeq ORF 675 bp
Locus ID 2287
UniProt ID Q00688
Cytogenetics 14q21.2
Domains FKBP
Protein Families Druggable Genome, Stem cell - Pluripotency
MW 25.2 kDa
Summary The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin. [provided by RefSeq, Sep 2008]
Write Your Own Review
You're reviewing:FKBP25 (FKBP3) (NM_002013) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202200L1 Lenti ORF clone of Human FK506 binding protein 3, 25kDa (FKBP3), Myc-DDK-tagged 10 ug
$600.00
RC202200L2 Lenti ORF clone of Human FK506 binding protein 3, 25kDa (FKBP3), mGFP tagged 10 ug
$600.00
RC202200L3 Lenti ORF clone of Human FK506 binding protein 3, 25kDa (FKBP3), Myc-DDK-tagged 10 ug
$600.00
RC202200L4 Lenti ORF clone of Human FK506 binding protein 3, 25kDa (FKBP3), mGFP tagged 10 ug
$600.00
RG202200 FKBP3 (tGFP-tagged) - Human FK506 binding protein 3, 25kDa (FKBP3) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC118888 FKBP3 (untagged)-Human FK506 binding protein 3, 25kDa (FKBP3) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.