RAB39B (NM_171998) Human Mass Spec Standard

SKU
PH302178
RAB39B MS Standard C13 and N15-labeled recombinant protein (NP_741995)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202178]
Predicted MW 24.6 kDa
Protein Sequence
Protein Sequence
>RC202178 protein sequence
Red=Cloning site Green=Tags(s)

MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER
FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK
LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR
CLC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_741995
RefSeq Size 3512
RefSeq ORF 639
Synonyms BGMR; MRX72; WSMN; WSN
Locus ID 116442
UniProt ID Q96DA2
Cytogenetics Xq28
Summary This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB39B (NM_171998) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406800 RAB39B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406800 Transient overexpression lysate of RAB39B, member RAS oncogene family (RAB39B) 100 ug
$436.00
TP302178 Recombinant protein of human RAB39B, member RAS oncogene family (RAB39B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.