RAB39B (NM_171998) Human Tagged ORF Clone

SKU
RC202178
RAB39B (Myc-DDK-tagged)-Human RAB39B, member RAS oncogene family (RAB39B)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RAB39B
Synonyms BGMR; MRX72; WSMN; WSN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202178 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCCATCTGGCTGTACCAGTTCCGGCTCATTGTCATCGGGGATTCCACAGTGGGCAAGTCCTGCC
TGATCCGCCGCTTCACCGAGGGTCGCTTTGCCCAGGTTTCTGACCCCACCGTGGGGGTGGATTTTTTCTC
CCGCTTGGTGGAGATCGAGCCAGGAAAACGCATCAAGCTCCAGATCTGGGATACCGCGGGTCAAGAGAGG
TTCAGATCCATCACTCGCGCCTACTACAGGAACTCAGTAGGTGGTCTTCTCTTATTTGACATTACCAACC
GCAGGTCCTTCCAGAATGTCCATGAGTGGTTAGAAGAGACCAAAGTACACGTTCAGCCCTACCAAATTGT
ATTTGTTCTGGTGGGTCACAAGTGTGACCTGGATACACAGAGGCAAGTGACTCGCCACGAGGCCGAGAAA
CTGGCTGCTGCATACGGCATGAAGTACATTGAAACGTCAGCCCGAGATGCCATTAATGTGGAGAAAGCCT
TCACAGACCTGACAAGAGACATATATGAGCTGGTTAAAAGGGGGGAGATTACAATCCAGGAGGGCTGGGA
AGGGGTGAAGAGTGGATTTGTACCAAATGTGGTTCACTCTTCAGAAGAGGTTGTCAAATCAGAGAGGAGA
TGTTTGTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202178 protein sequence
Red=Cloning site Green=Tags(s)

MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQER
FRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEK
LAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERR
CLC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_171998
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_171998.4
RefSeq Size 3512 bp
RefSeq ORF 642 bp
Locus ID 116442
UniProt ID Q96DA2
Cytogenetics Xq28
Protein Families Druggable Genome
MW 24.6 kDa
Summary This gene encodes a member of the Rab family of proteins. Rab proteins are small GTPases that are involved in vesicular trafficking. Mutations in this gene are associated with X-linked cognitive disability. [provided by RefSeq, Aug 2013]
Write Your Own Review
You're reviewing:RAB39B (NM_171998) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202178L1 Lenti ORF clone of Human RAB39B, member RAS oncogene family (RAB39B), Myc-DDK-tagged 10 ug
$600.00
RC202178L2 Lenti ORF clone of Human RAB39B, member RAS oncogene family (RAB39B), mGFP tagged 10 ug
$600.00
RC202178L3 Lenti ORF clone of Human RAB39B, member RAS oncogene family (RAB39B), Myc-DDK-tagged 10 ug
$600.00
RC202178L4 Lenti ORF clone of Human RAB39B, member RAS oncogene family (RAB39B), mGFP tagged 10 ug
$600.00
RG202178 RAB39B (tGFP-tagged) - Human RAB39B, member RAS oncogene family (RAB39B) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC124691 RAB39B (untagged)-Human RAB39B, member RAS oncogene family (RAB39B) 10 ug
$300.00
SC323711 RAB39B (untagged)-Human RAB39B, member RAS oncogene family (RAB39B) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.