FKBP7 (NM_181342) Human Mass Spec Standard

SKU
PH302176
FKBP7 MS Standard C13 and N15-labeled recombinant protein (NP_851939)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202176]
Predicted MW 25.8 kDa
Protein Sequence
Protein Sequence
>RC202176 protein sequence
Red=Cloning site Green=Tags(s)

MPKTMHFLFRFIVFFYLWGLFTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK
FYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIE
LYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFIS
PKEYNVYQHDEL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_851939
RefSeq Size 2904
RefSeq ORF 666
Synonyms FKBP23; PPIase
Locus ID 51661
UniProt ID Q9Y680
Cytogenetics 2q31.2
Summary The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. Members of this family exhibit PPIase activity and function as molecular chaperones. A similar protein in mouse is located in the endoplasmic reticulum and binds calcium. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:FKBP7 (NM_181342) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405796 FKBP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427593 FKBP7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405796 Transient overexpression lysate of FK506 binding protein 7 (FKBP7), transcript variant 1 100 ug
$436.00
LY427593 Transient overexpression lysate of FK506 binding protein 7 (FKBP7), transcript variant 2 100 ug
$436.00
TP302176 Recombinant protein of human FK506 binding protein 7 (FKBP7), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.