EAP30 (SNF8) (NM_007241) Human Mass Spec Standard

SKU PH302137

SNF8 MS Standard C13 and N15-labeled recombinant protein (NP_009172)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202137]
• Predicted MW: 28.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC202137 protein sequence; Red=Cloning site Green=Tags(s); ; MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQD; MCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVS; QDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERAR; QVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITAEEAREALP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_009172
• RefSeq Size: 1226
• RefSeq ORF: 774
• Synonyms: Dot3; EAP30; VPS22
• Locus ID: 11267
• UniProt ID: Q96H20
• Cytogenetics: 17q21.32
• Summary: The protein encoded by this gene is a component of the endosomal sorting complex required for transport II (ESCRT-II), which regulates the movement of ubiquitinylated transmembrane proteins to the lysosome for degradation. This complex also interacts with the RNA polymerase II elongation factor (ELL) to overcome the repressive effects of ELL on RNA polymerase II activity. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Families: Transcription Factors
• Protein Pathways: Endocytosis