SNAP25 (NM_003081) Human Mass Spec Standard

SKU
PH302068
SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_003072)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202068]
Predicted MW 23.3 kDa
Protein Sequence
Protein Sequence
>RC202068 protein sequence
Red=Cloning site Green=Tags(s)

MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQD
MKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND
ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003072
RefSeq Size 2069
RefSeq ORF 618
Synonyms bA416N4.2; CMS18; dJ1068F16.2; RIC-4; RIC4; SEC9; SNAP; SNAP-25; SUP
Locus ID 6616
UniProt ID P60880
Cytogenetics 20p12.2
Summary Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:SNAP25 (NM_003081) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH312596 SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_570824) 10 ug
$3,255.00
LC408904 SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418912 SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408904 Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 100 ug
$436.00
LY418912 Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1 100 ug
$436.00
TP302068 Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1, 20 µg 20 ug
$737.00
TP312596 Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.