MVK (NM_000431) Human Mass Spec Standard

SKU
PH301971
MVK MS Standard C13 and N15-labeled recombinant protein (NP_000422)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201971]
Predicted MW 42.5 kDa
Protein Sequence
Protein Sequence
>RC201971 protein sequence
Red=Cloning site Green=Tags(s)

MLSEVLLVSAPGKVILHGEHAVVHGKVALAVSLNLRTFLRLQPHSNGKVDLSLPNIGIKRAWDVARLQSL
DTSFLEQGDVTTPTSEQVEKLKEVAGLPDDCAVTERLAVLAFLYLYLSICRKQRALPSLDIVVWSELPPG
AGLGSSAAYSVCLAAALLTVCEEIPNPLKDGDCVNRWTKEDLELINKWAFQGERMIHGNPSGVDNAVSTW
GGALRYHQGKISSLKRSPALQILLTNTKVPRNTRALVAGVRNRLLKFPEIVAPLLTSIDAISLECERVLG
EMGEAPAPEQYLVLEELIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQ
PEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000422
RefSeq Size 2084
RefSeq ORF 1188
Synonyms LRBP; MK; MVLK; POROK3
Locus ID 4598
UniProt ID Q03426
Cytogenetics 12q24.11
Summary This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Terpenoid backbone biosynthesis
Write Your Own Review
You're reviewing:MVK (NM_000431) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325616 MVK MS Standard C13 and N15-labeled recombinant protein (NP_001107657) 10 ug
$3,255.00
LC424723 MVK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426476 MVK HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424723 Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 1 100 ug
$436.00
LY426476 Transient overexpression lysate of mevalonate kinase (MVK), transcript variant 2 100 ug
$436.00
TP301971 Recombinant protein of human mevalonate kinase (MVK), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325616 Recombinant protein of human mevalonate kinase (MVK), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.