DCTN6 (NM_006571) Human Mass Spec Standard

SKU
PH301937
DCTN6 MS Standard C13 and N15-labeled recombinant protein (NP_006562)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201937]
Predicted MW 20.7 kDa
Protein Sequence
Protein Sequence
>RC201937 protein sequence
Red=Cloning site Green=Tags(s)

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI
TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN
TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006562
RefSeq Size 1126
RefSeq ORF 570
Synonyms p27; WS-3; WS3
Locus ID 10671
UniProt ID O00399
Cytogenetics 8p12
Summary The protein encoded by this gene contains an RGD (Arg-Gly-Asp) motif in the N-terminal region, which confers adhesive properties to macromolecular proteins like fibronectin. It shares a high degree of sequence similarity with the mouse homolog, which has been suggested to play a role in mitochondrial biogenesis. The exact biological function of this gene is not known. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DCTN6 (NM_006571) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401967 DCTN6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401967 Transient overexpression lysate of dynactin 6 (DCTN6) 100 ug
$436.00
TP301937 Recombinant protein of human dynactin 6 (DCTN6), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.