DCTN6 (NM_006571) Human Tagged ORF Clone

SKU
RC201937
DCTN6 (Myc-DDK-tagged)-Human dynactin 6 (DCTN6)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DCTN6
Synonyms p27; WS-3; WS3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201937 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGAAGACTCAAAAGAGTGTGAAGATTGCTCCTGGAGCAGTTGTATGTGTAGAAAGTGAAATCA
GAGGAGATGTAACTATCGGACCTCGGACAGTGATCCACCCTAAAGCAAGAATTATTGCGGAAGCCGGGCC
AATAGTGATTGGCGAAGGGAACCTAATAGAAGAACAGGCCCTTATCATAAATGCTTACCCAGATAATATC
ACTCCTGACACTGAAGATCCAGAACCAAAACCTATGATCATTGGCACCAATAATGTGTTTGAAGTTGGCT
GTTATTCCCAAGCCATGAAGATGGGAGATAATAATGTCATTGAATCAAAAGCATATGTAGGCAGAAATGT
AATATTGACAAGTGGCTGCATCATTGGGGCTTGTTGCAACCTAAATACATTTGAAGTCATCCCTGAGAAT
ACGGTGATCTATGGTGCAGACTGCCTTCGTCGGGTGCAGACTGAGCGACCGCAGCCCCAGACACTACAGC
TGGATTTCTTGATGAAAATCTTGCCAAATTACCACCACCTAAAGAAGACTATGAAAGGAAGCTCAACTCC
AGTAAAGAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201937 protein sequence
Red=Cloning site Green=Tags(s)

MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNI
TPDTEDPEPKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPEN
TVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006571
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006571.4
RefSeq Size 1126 bp
RefSeq ORF 573 bp
Locus ID 10671
UniProt ID O00399
Cytogenetics 8p12
Domains hexapep
MW 20.7 kDa
Summary The protein encoded by this gene contains an RGD (Arg-Gly-Asp) motif in the N-terminal region, which confers adhesive properties to macromolecular proteins like fibronectin. It shares a high degree of sequence similarity with the mouse homolog, which has been suggested to play a role in mitochondrial biogenesis. The exact biological function of this gene is not known. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DCTN6 (NM_006571) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201937L1 Lenti ORF clone of Human dynactin 6 (DCTN6), Myc-DDK-tagged 10 ug
$600.00
RC201937L2 Lenti ORF clone of Human dynactin 6 (DCTN6), mGFP tagged 10 ug
$600.00
RC201937L3 Lenti ORF clone of Human dynactin 6 (DCTN6), Myc-DDK-tagged 10 ug
$600.00
RC201937L4 Lenti ORF clone of Human dynactin 6 (DCTN6), mGFP tagged 10 ug
$600.00
RG201937 DCTN6 (tGFP-tagged) - Human dynactin 6 (DCTN6) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116001 DCTN6 (untagged)-Human dynactin 6 (DCTN6) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.