RNF141 (NM_016422) Human Mass Spec Standard

SKU PH301861

RNF141 MS Standard C13 and N15-labeled recombinant protein (NP_057506)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201861]
• Predicted MW: 25.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC201861 protein sequence; Red=Cloning site Green=Tags(s); ; MGQQISDQTQLVINKLPEKVAKHVTLVRESGSLTYEEFLGRVAELNDVTAKVASGQEKHLLFEVQPGSDS; SAFWKVVVRVVCTKINKSSGIVEASRIMNLYQFIQLYKDITSQAAGVLAQSSTSEEPDENSSSVTSCQAS; LWMGRVKQLTDEEECCICMDGRADLILPCAHSFCQKCIDKWSDRHRNCPICRLQMTGANESWVVSDAPTE; DDMANYILNMADEAGQPHRP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057506
• RefSeq Size: 4084
• RefSeq ORF: 690
• Synonyms: RFP141; ZFP26; ZNF230
• Locus ID: 50862
• UniProt ID: Q8WVD5
• Cytogenetics: 11p15
• Summary: The protein encoded by this gene contains a RING finger, a motif known to be involved in protein-DNA and protein-protein interactions. Abundant expression of this gene was found in the testicular tissue of fertile men, but was not detected in azoospermic patients. Studies of the mouse counterpart suggest that this gene may function as a testis specific transcription factor during spermatogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transcription Factors