OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RRAGB (NM_006064) Human Mass Spec Standard

Be the first to review this product
SKU
PH301860
RRAGB MS Standard C13 and N15-labeled recombinant protein (NP_006055)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA331223 Rabbit Polyclonal Anti-RRAGB Antibody
100 ul
$585.00
LY416897 Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBs (as WB positive control) 100 ug
$436.00

Other products for "RRAGB or NM_006064"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201860
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC201860 protein sequence
Red=Cloning site Green=Tags(s)

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR
RLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ
SCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIV
YQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAA
SFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006055
RefSeq Size 2143
RefSeq ORF 1038
Synonyms bA465E19.1; RAGB
Locus ID 10325
UniProt ID Q5VZM2
Cytogenetics Xp11.21
Summary Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RRAGB" proteins (5)
SKU Description Size Price
LC413855 Lyophilized RRAGB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416897 Lyophilized RRAGB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413855 Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBl (as WB positive control) 100 ug
$436.00
LY416897 Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBs (as WB positive control) 100 ug
$436.00
TP301860 Recombinant protein of human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products