RRAGB (NM_006064) Human Mass Spec Standard

SKU
PH301860
RRAGB MS Standard C13 and N15-labeled recombinant protein (NP_006055)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201860]
Predicted MW 40.2 kDa
Protein Sequence
Protein Sequence
>RC201860 protein sequence
Red=Cloning site Green=Tags(s)

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR
RLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ
SCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIV
YQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAA
SFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006055
RefSeq Size 2143
RefSeq ORF 1038
Synonyms bA465E19.1; RAGB
Locus ID 10325
UniProt ID Q5VZM2
Cytogenetics Xp11.21
Summary Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RRAGB (NM_006064) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413855 RRAGB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416897 RRAGB HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413855 Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBl 100 ug
$436.00
LY416897 Transient overexpression lysate of Ras-related GTP binding B (RRAGB), transcript variant RAGBs 100 ug
$436.00
TP301860 Recombinant protein of human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.