RRAGB (NM_006064) Human Tagged ORF Clone

SKU
RC201860
RRAGB (Myc-DDK-tagged)-Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RRAGB
Synonyms bA465E19.1; RAGB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201860 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAGAATCTGACTCTGAGAAAACGACGGAGAAAGAAAATCTGGGGCCGAGAATGGATCCACCACTAG
GGGAACCGGAAGGATCGCTTGGGTGGGTGCTACCAAATACAGCCATGAAGAAAAAGGTGCTGTTGATGGG
TAAAAGTGGGTCTGGTAAGACCAGCATGAGGTCTATTATCTTTGCAAATTATATTGCCAGAGACACACGT
CGCCTTGGCGCAACAATTGATGTAGAACATTCTCATGTTCGATTTCTGGGAAACCTGGTATTGAACCTGT
GGGATTGTGGTGGGCAAGACACCTTCATGGAAAATTATTTCACTAGCCAACGGGACAACATCTTCCGAAA
TGTGGAGGTTCTGATTTATGTCTTTGATGTGGAGAGCCGCGAACTGGAAAAGGACATGCACTATTACCAA
TCATGCCTGGAGGCCATTCTGCAGAATTCTCCAGATGCCAAAATATTTTGCTTGGTACACAAAATGGATC
TGGTACAGGAGGATCAACGGGACCTGATTTTTAAAGAGCGAGAAGAAGATTTGAGGCGTTTGTCTCGCCC
ATTGGAATGTTCTTGTTTCCGAACATCTATCTGGGATGAAACCCTCTATAAGGCTTGGTCCAGCATAGTT
TATCAGCTGATTCCCAATGTTCAGCAGCTGGAAATGAACCTAAGGAATTTTGCTGAAATTATCGAAGCTG
ATGAAGTACTTCTTTTTGAGAGAGCTACTTTTCTGGTAATTTCTCACTATCAGTGTAAAGAGCAGCGTGA
TGCCCATAGATTTGAGAAAATAAGCAACATTATTAAGCAGTTCAAGCTGAGCTGCAGCAAGCTGGCTGCC
TCTTTCCAGAGTATGGAAGTCAGGAACTCTAACTTCGCTGCTTTCATTGACATCTTTACATCCAACACTT
ATGTGATGGTTGTGATGTCTGATCCGTCCATTCCTTCTGCAGCTACTCTGATCAACATCCGCAATGCCAG
GAAACACTTTGAAAAGCTGGAAAGAGTGGATGGACCAAAGCAGTGTCTTCTCATGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201860 protein sequence
Red=Cloning site Green=Tags(s)

MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR
RLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQ
SCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIV
YQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAA
SFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006064
ORF Size 1038 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006064.5
RefSeq Size 2143 bp
RefSeq ORF 1041 bp
Locus ID 10325
UniProt ID Q5VZM2
Cytogenetics Xp11.21
Domains Gtr1_RagA
MW 40.2 kDa
Summary Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RRAGB (NM_006064) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201860L1 Lenti ORF clone of Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, Myc-DDK-tagged 10 ug
$986.00
RC201860L2 Lenti ORF clone of Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, mGFP tagged 10 ug
$986.00
RC201860L3 Lenti ORF clone of Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, Myc-DDK-tagged 10 ug
$986.00
RC201860L4 Lenti ORF clone of Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs, mGFP tagged 10 ug
$986.00
RG201860 RRAGB (tGFP-tagged) - Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs 10 ug
$886.00
SC116386 RRAGB (untagged)-Human Ras-related GTP binding B (RRAGB), transcript variant RAGBs 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.