CAPZA1 (NM_006135) Human Mass Spec Standard

SKU
PH301642
CAPZA1 MS Standard C13 and N15-labeled recombinant protein (NP_006126)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201642]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC201642 protein sequence
Red=Cloning site Green=Tags(s)

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY
EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF
CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK
DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
KEMQNA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006126
RefSeq Size 2758
RefSeq ORF 858
Synonyms CAPPA1; CAPZ; CAZ1
Locus ID 829
UniProt ID P52907
Cytogenetics 1p13.2
Summary CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CAPZA1 (NM_006135) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401848 CAPZA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401848 Transient overexpression lysate of capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) 100 ug
$436.00
TP301642 Recombinant protein of human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.