CAPZA1 (NM_006135) Human Tagged ORF Clone

SKU
RC201642
CAPZA1 (Myc-DDK-tagged)-Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAPZA1
Synonyms CAPPA1; CAPZ; CAZ1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201642 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGACTTCGATGATCGTGTGTCGGATGAGGAGAAGGTACGCATAGCTGCTAAATTCATCACTCATG
CACCCCCAGGGGAATTTAATGAAGTATTCAATGACGTTCGGCTACTACTTAATAATGACAATCTCCTCAG
GGAAGGGGCAGCACATGCATTTGCCCAGTATAACATGGATCAGTTCACGCCTGTGAAGATAGAAGGATAT
GAAGATCAGGTCTTAATTACAGAGCACGGTGACCTGGGTAATAGCAGATTTTTAGATCCAAGAAACAAAA
TTTCCTTTAAATTTGACCACTTACGGAAAGAAGCAAGTGACCCCCAGCCAGAAGAAGCAGATGGAGGTCT
GAAGTCTTGGAGAGAATCCTGTGACAGTGCTTTAAGAGCCTATGTGAAAGACCATTATTCCAACGGCTTC
TGTACTGTTTATGCTAAAACTATCGATGGGCAACAGACTATTATTGCATGTATTGAAAGCCACCAGTTTC
AGCCTAAAAACTTCTGGAATGGTCGTTGGAGATCAGAGTGGAAGTTCACCATCACACCACCTACAGCCCA
GGTGGTTGGCGTGCTTAAGATTCAGGTTCACTATTATGAAGATGGCAATGTTCAGTTGGTTAGTCATAAA
GATGTACAGGATTCACTAACTGTTTCGAATGAAGCCCAAACTGCCAAGGAGTTTATTAAAATCATAGAGA
ATGCAGAAAATGAGTATCAGACAGCAATTAGTGAAAACTATCAAACAATGTCAGATACCACATTCAAGGC
CTTGCGCCGGCAGCTTCCAGTTACCCGCACCAAAATCGACTGGAACAAGATACTCAGCTACAAGATTGGC
AAAGAAATGCAGAATGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201642 protein sequence
Red=Cloning site Green=Tags(s)

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY
EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF
CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK
DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG
KEMQNA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006135
ORF Size 858 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006135.3
RefSeq Size 2758 bp
RefSeq ORF 861 bp
Locus ID 829
UniProt ID P52907
Cytogenetics 1p13.2
Domains F-actin_cap_A
MW 32.9 kDa
Summary CAPZA1 is a member of the F-actin capping protein alpha subunit family. This gene encodes the alpha subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CAPZA1 (NM_006135) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201642L1 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), Myc-DDK-tagged 10 ug
$600.00
RC201642L2 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), mGFP tagged 10 ug
$600.00
RC201642L3 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), Myc-DDK-tagged 10 ug
$600.00
RC201642L4 Lenti ORF clone of Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1), mGFP tagged 10 ug
$600.00
RG201642 CAPZA1 (tGFP-tagged) - Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC116306 CAPZA1 (untagged)-Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) 10 ug
$300.00
SC323780 CAPZA1 (untagged)-Human capping protein (actin filament) muscle Z-line, alpha 1 (CAPZA1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.