S100A4 (NM_019554) Human Mass Spec Standard

SKU PH301616

S100A4 MS Standard C13 and N15-labeled recombinant protein (NP_062427)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201616]
• Predicted MW: 11.7 kDa
• Protein Sequence:
  Protein Sequence

  >RC201616 protein sequence; Red=Cloning site Green=Tags(s); ; MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEV; DFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_062427
• RefSeq Size: 564
• RefSeq ORF: 303
• Synonyms: 18A2; 42A; CAPL; FSP1; MTS1; P9KA; PEL98
• Locus ID: 6275
• UniProt ID: P26447
• Cytogenetics: 1q21.3
• Summary: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]