OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Vimentin (VIM) (NM_003380) Human Mass Spec Standard

Be the first to review this product
SKU
PH301546
VIM MS Standard C13 and N15-labeled recombinant protein (NP_003371)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA801297 VIM mouse monoclonal antibody, clone OTI1A9 (formerly 1A9) 100 ul
$447.00
LY401165 Transient overexpression lysate of vimentin (VIM) (as WB positive control) 100 ug
$436.00

Other products for "Vimentin or NM_003380"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201546
Predicted MW 53.5 kDa
Protein Sequence
Protein Sequence
>RC201546 representing NM_003380
Red=Cloning site Green=Tags(s)

MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRL
RSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKG
QGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDV
DNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVA
AKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEEN
FAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSS
LNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003371
RefSeq Size 1847
RefSeq ORF 1398
Locus ID 7431
UniProt ID P08670
Cytogenetics 10p13
Summary This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. provided by RefSeq, Aug 2017
Protein Families ES Cell Differentiation/IPS
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Vimentin" proteins (3)
SKU Description Size Price
LC401165 Lyophilized VIM HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401165 Transient overexpression lysate of vimentin (VIM) (as WB positive control) 100 ug
$436.00
TP301546 Recombinant protein of human vimentin (VIM), 20 µg 20 ug
$867.00

file-alt Citations

Non-invasive intravital imaging of cellular differentiation with a bright red-excitable fluorescent protein
Chu, Haynes, Corbel et al
Nat. Methods (2014)
Cited by 255
AI Summary: In this study, OriGene products—specifically human pyruvate dehydrogenase (NM_000284), human peroxisomal membrane protein (NM_018663.1), and human vimentin (NM_003380.3)—were used as genetic templates to generate fluorescent protein fusion constructs for validating and visualizing cellular differentiation in vivo.
Snippet: human keratin 18 (NM_199187.1, Open Biosystems), EcoRI and NotI;yeast Lifeact (IDT DNA), BamHI and NotI;human pyruvate dehydrogenase, (NM_000284, OriGene), AgeI and NotI;human peroxisomal membrane protein (NM_018663.1, OriGene), NotI and AgeI;human vimentin (NM_003380.3, OriGene), NheI and BamHI;chicken paxillin (NM_204984.1, C. Waterman, NIH), NheI and BamHI;mouse mannosidase II (NM_008549.2, J. …
Confined activation and subdiffractive localization enables whole-cell PALM with genetically expressed probes
York, Ghitani, Vaziri et al
Nat. Methods (2011) 8 (4), 327-33 DOI: 10.1038/nmeth.1571
Cited by 172
AI Summary: OriGene contributed to this study by providing the cDNA for the mitochondrial targeting signal (MTS) of human cytochrome C oxidase subunit VIII (product: NM_004074.2), which was used to generate fusion constructs for super-resolution imaging of mitochondrial structures.
Snippet: left to right on a picosecond timescale, illuminating a line, and a galvanometric mirror scans the illuminated line up-down on a ... cDNA for the mitochondrial targeting signal (MTS) of human cytochrome C oxidase subunit VIII (cDNA source: Origene;NM_004074.2) was amplified
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products