BRP44L (MPC1) (NM_016098) Human Mass Spec Standard

SKU PH301461

BRP44L MS Standard C13 and N15-labeled recombinant protein (NP_057182)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201461]
• Predicted MW: 12.3 kDa
• Protein Sequence:
  Protein Sequence

  >RC201461 protein sequence; Red=Cloning site Green=Tags(s); ; MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA; YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_057182
• RefSeq Size: 977
• RefSeq ORF: 327
• Synonyms: BRP44L; CGI-129; MPYCD; SLC54A1
• Locus ID: 51660
• UniProt ID: Q9Y5U8
• Cytogenetics: 6q27
• Summary: The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene. [provided by RefSeq, Aug 2012]