BRP44L (MPC1) (NM_016098) Human Tagged ORF Clone

SKU
RC201461
MPC1 (Myc-DDK-tagged)-Human brain protein 44-like (BRP44L)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BRP44L
Synonyms BRP44L; CGI-129; MPYCD; SLC54A1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201461 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGCGCGTTGGTGCGGAAAGCGGCGGACTATGTCCGAAGCAAGGATTTCCGGGACTACCTCATGA
GTACGCACTTCTGGGGCCCAGTAGCCAACTGGGGTCTTCCCATTGCTGCCATCAATGATATGAAAAAGTC
TCCAGAGATTATCAGTGGGCGGATGACATTTGCCCTCTGTTGCTATTCTTTGACATTCATGAGATTTGCC
TACAAGGTACAGCCTCGGAACTGGCTTCTGTTTGCATGCCACGCAACAAATGAAGTAGCCCAGCTCATCC
AGGGAGGGCGGCTTATCAAACACGAGATGACTAAAACGGCATCTGCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201461 protein sequence
Red=Cloning site Green=Tags(s)

MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA
YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_016098
ORF Size 327 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016098.4
RefSeq Size 977 bp
RefSeq ORF 330 bp
Locus ID 51660
UniProt ID Q9Y5U8
Cytogenetics 6q27
Domains UPF0041
MW 12.3 kDa
Summary The protein encoded by this gene is part of an MPC1/MPC2 heterodimer that is responsible for transporting pyruvate into mitochondria. The encoded protein is found in the inner mitochondrial membrane. Defects in this gene are a cause of mitochondrial pyruvate carrier deficiency. Several transcript variants, some protein coding and one non-protein coding, have been found for this gene. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:BRP44L (MPC1) (NM_016098) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201461L3 Lenti ORF clone of Human brain protein 44-like (BRP44L), Myc-DDK-tagged 10 ug
$450.00
RC201461L4 Lenti ORF clone of Human brain protein 44-like (BRP44L), mGFP tagged 10 ug
$450.00
RG201461 MPC1 (tGFP-tagged) - Human brain protein 44-like (BRP44L) 10 ug
$489.00
SC127044 MPC1 (untagged)-Human brain protein 44-like (BRP44L) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.