Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard

SKU
PH301451
APOO MS Standard C13 and N15-labeled recombinant protein (NP_077027)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201451]
Predicted MW 22.3 kDa
Protein Sequence
Protein Sequence
>RC201451 protein sequence
Red=Cloning site Green=Tags(s)

MFKVIQRSVGPASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQLEESISQLRHY
CEPYTTWCQETYSQTKPKMQSLVQWGLDSYDYLQNAPPGFFPRLGVIGFAGLIGLLLARGSKIKKLVYPP
GFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077027
RefSeq Size 1134
RefSeq ORF 594
Synonyms FAM121B; Mic23; MIC26; MICOS26; My025
Locus ID 79135
UniProt ID Q9BUR5
Cytogenetics Xp22.11
Summary This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16.[provided by RefSeq, Sep 2009]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:Apolipoprotein O (APOO) (NM_024122) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411353 APOO HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411353 Transient overexpression lysate of apolipoprotein O (APOO), transcript variant 1 100 ug
$436.00
TP301451 Recombinant protein of human apolipoprotein O (APOO), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.