Apolipoprotein O (APOO) Rabbit Polyclonal Antibody

SKU TA343926

Rabbit Polyclonal Anti-FAM121B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the C terminal of human FAM121B. Synthetic peptide located within the following region: LYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: apolipoprotein O
• Database Link:
  NP_077027
  Q9BUR5
• Background: FAM121B belongs to the FAM121 family and the function remains unknown.
• Synonyms: FAM121B; Mic23; MIC26; My025
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 93%; Mouse: 93%; Pig: 86%; Rat: 86%; Bovine: 86%

Reference Data

• Protein Families: Secreted Protein, Transmembrane